PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00107.1_g00034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 421aa    MW: 49183.2 Da    PI: 6.7322
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00107.1_g00034.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-18215261148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT+eEd +l+++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
  Rsa1.0_00107.1_g00034.1 215 KGQWTAEEDRILIQLVEKYGLRKWSHIAQVLP-GRIGKQCRERWHNHL 261
                              799*****************************.*************97 PP

2Myb_DNA-binding52.11.5e-16267309145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +  W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  Rsa1.0_00107.1_g00034.1 267 KETWSEEEDRVLIEFHKEIGNK-WAEIAKRLP-GRTENSIKNHWN 309
                              578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.067210265IPR017930Myb domain
SuperFamilySSF466891.26E-32213308IPR009057Homeodomain-like
SMARTSM007173.7E-18214263IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-27216266IPR009057Homeodomain-like
CDDcd001672.43E-16218261No hitNo description
PfamPF139211.2E-20218275No hitNo description
SMARTSM007174.8E-16266314IPR001005SANT/Myb domain
PROSITE profilePS5129421.16266316IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-22267314IPR009057Homeodomain-like
CDDcd001672.56E-12269312No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MENYVNESGF APLNQTIFIR DQDHMKEEDF PFEVVDQSKP TSFLQDFHHL DHDNQFDHHH  60
QYHGSTSSNP LFGIQMTSSC ANNAPYQHCS YQENMVDFYE TKPQLMNHHF QAAENSYFTR  120
NHHQEINLVD DNDPMNLEQN NMMMMRMIPF DYPPIETINK PMNFVMPDEV SCVSADNNSY  180
RAMSFNKTKP LLTRKLSSSS SSSSWKGKKK TTLVKGQWTA EEDRILIQLV EKYGLRKWSH  240
IAQVLPGRIG KQCRERWHNH LRPDIKKETW SEEEDRVLIE FHKEIGNKWA EIAKRLPGRT  300
ENSIKNHWNA TKRRQFSKRK CRSKYPRSSL LQDYIKSLDV GVLSSSSVPA RGRRKVSNKK  360
KDVVAVEEKE EEFYGQDRIV PECVFTDDFG FNEKLLEEGC SIDSLLDDLP QPDIDAFVHG  420
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-452133152104C-Myb DNA-Binding Domain
1mse_C1e-452133152104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1760030.0AF176003.2 Arabidopsis thaliana putative transcription factor (MYB98) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013668307.10.0PREDICTED: transcription factor MYB98-like
RefseqXP_013725967.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L20.0MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A078CNU10.0A0A078CNU1_BRANA; BnaA01g09580D protein
STRINGBra013346.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.10.0myb domain protein 98